Overview

  • Product name

    Anti-RBED1/ELMOD3 antibody
  • Description

    Rabbit polyclonal to RBED1/ELMOD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RBED1/ELMOD3 aa 1-102.
    Sequence:

    MNEKSCSFHSKEELRDGQGERLSAGYSPSYDKDKSVLAFRGIPISELKNH GILQALTTEAYEWEPRVVSTEVVRAQEEWEAVDTIQPETGSQASSEQPGQ LI


    Database link: Q96FG2

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human lung and pancreas tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as RBED1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab237508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/5000. Predicted molecular weight: 43 kDa.

Target

  • Relevance

    RBED1 (RNA binding motif and ELMO domain 1) contains an ELMO domain. There are 6 named isoforms produced by alternative splicing.
  • Database links

  • Alternative names

    • C330008I15Rik antibody
    • ELMO domain containing protein 3 antibody
    • ELMOD 3 antibody
    • ELMOD3 antibody
    • FLJ21977 antibody
    • FLJ35601 antibody
    • MGC111036 antibody
    • RBED 1 antibody
    • RBM 29 antibody
    • RBM29 antibody
    • RNA binding motif and ELMO domain 1 antibody
    • RNA binding motif and ELMO domain containing protein 1 antibody
    • RNA binding motif and ELMO/CED 12 domain 1 antibody
    • RNA binding motif protein 29 antibody
    • RNA binding protein 29 antibody
    see all

Images

  • Anti-RBED1/ELMOD3 antibody (ab237508) at 1/500 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for RBED1/ELMOD3 using ab237508 at 1/166 dilutionin ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • Paraffin-embedded human lung tissue stained for RBED1/ELMOD3 with ab237508 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human pancreas tissue stained for RBED1/ELMOD3 with ab237508 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab237508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up