Overview

  • Product name

    Anti-RBM41 antibody
  • Description

    Rabbit polyclonal to RBM41
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human RBM41 aa 1-413.
    Sequence:

    MKRVNSCVKSDEHVLEELETEGERQLKSLLQHQLDTSVSIEECMSKKESF APGTMYKPFGKEAAGTMTLSQFQTLHEKDQETASLRELGLNETEILIWKS HVSGEKKTKLRATPEAIQNRLQDIEERISERQRILCLPQRFAKSKQLTRR EMEIEKSLFQGADRHSFLKALYYQDEPQKKNKGDPMNNLESFYQEMIMKK RLEEFQLMRGEPFASHSLVSATSVGDSGTAESPSLLQDKGKQAAQGKGPS LHVANVIDFSPEQCWTGPKKLTQPIEFVPEDEIQRNRLSEEEIRKIPMFS SYNPGEPNKVLYLKNLSPRVTERDLVSLFARFQEKKGPPIQFRMMTGRMR GQAFITFPNKEIAWQALHLVNGYKLHGKILVIEFGKNKKQRSNLQATSLI SCATGSTTEISGS


    Database link: Q96IZ5-1

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 47 kDa.

Target

Images

  • Anti-RBM41 antibody (ab235533) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 47 kDa

  • Paraffin-embedded human skin tissue stained for RBM41 with ab235533 at 1/100 dilution in immunohistochemical analysis.

References

ab235533 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up