Overview

  • Product name

  • Description

    Rabbit polyclonal to RBMS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human RBMS3 aa 126-175 (N terminal). The exact sequence is proprietary.
    Sequence:

    GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA


    Database link: Q6XE24

  • Positive control

    • HepG2 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab51504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Peptide ELISA: 1/312500.

WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 47 kDa (predicted molecular weight: 48 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • RNA binding motif, single stranded interacting protein 3 antibody
    • RNA binding motif, single stranded interacting protein antibody
    • RNA binding motif, single stranded-interacting 3 antibody
    • RNA binding protein antibody

Images

References

ab51504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab51504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up