Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP1
  • Host species

    Rabbit
  • Specificity

    ab218253 may detect RBP2 and to a lesser extent, RBP7.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human RBP1 aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQ V


    Database link: P09455

  • Positive control

    • Rat ovary tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Intracellular transport of retinol.
  • Tissue specificity

    Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular retinol binding protein antibody
    • Cellular retinol-binding protein antibody
    • Cellular retinol-binding protein I antibody
    • CRABP I antibody
    • CRBP antibody
    • CRBP-I antibody
    • CRBP1 antibody
    • CRBPI antibody
    • RBP 1 antibody
    • RBP1 antibody
    • RBPC antibody
    • RET1_HUMAN antibody
    • Retinol binding protein 1 cellular antibody
    • Retinol-binding protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat ovary tissue labeling RBP1 with ab218253 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up