Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human RBP1 aa 2-135. Expressed in E. coli. N-terminal tags.
    Sequence:

    PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMI IRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGE KEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ


    Database link: P09455-1

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human RBP1 protein. Pig liver tissue lysate. HEK-293T cell lysate. Rat testis tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for RBP1 with ab233296 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-RBP1 antibody (ab233296) at 2 µg/ml

    Lane 1 : Pig liver tissue lysate
    Lane 2 : Human liver tissue lysate
    Lane 3 : Rat testis tissue lysate
    Lane 4 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-RBP1 antibody (ab233296) at 2 µg/ml + Recombinant human RBP1 protein

References

ab233296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up