Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Pig RBP2 aa 1-134. (Expressed in E.coli).
    Sequence:

    MTRDQNGTWEMESNDNFEGYMKALDIDFATRKIAVALTQTKIIEQDGDKF KTKTNSTFRNYDLDFTVGVEFDEYTKGLDNRNVKTLIIWEGDALVCVQKG EKENRGWKQWVEGDKLYLELTCGDQVCRQVFKK


    Database link: P50121

  • Positive control

    • WB: Pig and mouse small intestine lysates; Recombinant pig RBP2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function

    Intracellular transport of retinol.
  • Tissue specificity

    Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular retinol binding protein II antibody
    • Cellular retinol-binding protein II antibody
    • CRABP II antibody
    • Crbp 2 antibody
    • CRBP II antibody
    • CRBP-II antibody
    • CRBP2 antibody
    • CrbpII antibody
    • MGC159254 antibody
    • MGC159256 antibody
    • Rbp 2 antibody
    • Rbp2 antibody
    • RBPC2 antibody
    • RET2_HUMAN antibody
    • Retinol binding protein 2 antibody
    • Retinol binding protein 2 cellular antibody
    • Retinol-binding protein 2 antibody
    see all

Images

  • Anti-RBP2 antibody (ab231636) at 2 µg/ml + Pig small intestine lysate

    Predicted band size: 16 kDa

  • Anti-RBP2 antibody (ab231636) at 2 µg/ml + Mouse small intestine lysate

    Predicted band size: 16 kDa

  • Anti-RBP2 antibody (ab231636) at 2 µg/ml + Recombinant pig RBP2 protein

    Predicted band size: 16 kDa

References

ab231636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up