Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Pig
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human RBP2 aa 1-134. (Expressed in E.coli).
    Sequence:

    MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNF KTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKG EKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK


    Database link: P50120

  • Positive control

    • WB: Mouse, rat and pig small intestine lysate; Recombinant human RBP2 protein. IHC-P: Human rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for RBP2 using ab233514 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RBP2 antibody (ab233514) at 2 µg/ml + Pig small intestine lysate

    Predicted band size: 16 kDa

  • Anti-RBP2 antibody (ab233514) at 2 µg/ml + Rat small intestine lysate

    Predicted band size: 16 kDa

  • Anti-RBP2 antibody (ab233514) at 2 µg/ml + Mouse small intestine lysate

    Predicted band size: 16 kDa

  • Anti-RBP2 antibody (ab233514) at 2 µg/ml + Recombinant human RBP2 protein

    Predicted band size: 16 kDa

References

ab233514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up