Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP3/IRBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Rat RBP3/IRBP aa 1027-1129.
    Sequence:

    IKFSFHTNVFEDNIGYLRFDMFGDCELLIQVSELLVEHIWKKIVHTDALI IDMRFNIGGPTSSISALCSYFFDEAPPVLLDKIYNRPNDSISELWTHSQL TGERYGSKKSVAILTSGVTAGAAEEFTYIMKRLGRALVVGEVTSGGCQPP QTYHVDDTHLYITIPTARSVGATDGSSWEGVGVTPNVVVSSELALTRAKE ILQ


    Database link: G3V8Q4

  • Positive control

    • WB: Recombinant rat RBP3/IRBP protein; Mouse ear lysate.
  • General notes

    Previously labelled as RBP3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 135 kDa.

Target

  • Function

    IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.
  • Sequence similarities

    Belongs to the peptidase S41A family.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > interphotoreceptor matrix. Interphotoreceptor matrix that permeates the space between the retina and the contiguous layer of pigment epithelium cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • D10S64 antibody
    • D10S65 antibody
    • D10S66 antibody
    • Interphotoreceptor retinoid binding protein antibody
    • Interphotoreceptor retinoid-binding protein antibody
    • Interstitial retinol binding protein antibody
    • Interstitial retinol-binding protein antibody
    • IRBP antibody
    • RBP 3 antibody
    • rbp3 antibody
    • RBPI antibody
    • RET3_HUMAN antibody
    • Retinol binding protein 3 antibody
    • Retinol binding protein 3 interstitial antibody
    • Retinol-binding protein 3 antibody
    • RP66 antibody
    see all

Images

  • Anti-RBP3/IRBP antibody (ab233190) at 1 µg/ml + Mouse ear tissue lysate.

    Predicted band size: 135 kDa

  • Anti-RBP3/IRBP antibody (ab233190) at 2 µg/ml + Recombinant rat RBP3/IRBP protein fragment, comprised of residues 422 – 601, with an N-terminal His tag

    Predicted band size: 135 kDa

References

ab233190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up