Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Chicken
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Chicken RBP4 aa 22-196. (Expressed in E.coli).
    Sequence:

    ERDCRVSSFKVKENFDKNRYSGTWYAMAKKDPEGLFLQDNVVAQFTVDEN GQMSATAKGRVRLFNNWDVCADMIGSFTDTEDPAKFKMKYWGVASFLQKG NDDHWVVDTDYDTYALHYSCRELNEDGTCADSYSFVFSRDPKGLPPEAQK IVRQRQIDLCLDRKYRVIVHNGFCS


    Database link: P41263

  • Positive control

    • WB: Recombinant chicken RBP4 protein; Chicken serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function

    Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
  • Involvement in disease

    Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTTHUMP00000020114 antibody
    • OTTHUMP00000020115 antibody
    • OTTHUMP00000020116 antibody
    • Plasma retinol binding protein 4 antibody
    • Plasma retinol-binding protein antibody
    • Plasma retinol-binding protein(1-176) antibody
    • PRBP antibody
    • PRO2222 antibody
    • RBP antibody
    • RBP4 antibody
    • RDCCAS antibody
    • RET4_HUMAN antibody
    • Retinol binding protein 4 antibody
    • Retinol binding protein 4 interstitial antibody
    • Retinol binding protein 4 plasma antibody
    see all

Images

  • Anti-RBP4 antibody (ab231582) at 1 µg/ml + Chicken serum.

    Predicted band size: 23 kDa

  • Anti-RBP4 antibody (ab231582) at 2 µg/ml + Recombinant chicken RBP4 protein.

    Predicted band size: 23 kDa

References

ab231582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up