Anti-RBP4 antibody (ab231587)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RBP4 antibody
See all RBP4 primary antibodies -
Description
Rabbit polyclonal to RBP4 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Cow, Pig
Predicted to work with: Rabbit, Horse, Cat, Human, Chimpanzee -
Immunogen
Recombinant fragment (His-tag) corresponding to Pig RBP4 aa 19-201. (Expressed in E.coli)
Sequence:ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDEN GHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKG NDDHWIIDTDYDTYAVQYSCRLQNLDGTCADSYSFVFARDPHGFSPEVQK IVRQRQEELCLARQYRIITHNGYCDGKSERNIL
Database link: P27485 -
Positive control
- WB: Recombinant pig RBP4 protein; Cow liver lysate; Pig serum and liver lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231587 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa. |
Target
-
Function
Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. -
Involvement in disease
Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 450617 Chimpanzee
- Entrez Gene: 281444 Cow
- Entrez Gene: 100049790 Horse
- Entrez Gene: 5950 Human
- Entrez Gene: 397124 Pig
- Entrez Gene: 100009161 Rabbit
- Omim: 180250 Human
- SwissProt: M5AXY1 Cat
see all -
Alternative names
- OTTHUMP00000020114 antibody
- OTTHUMP00000020115 antibody
- OTTHUMP00000020116 antibody
see all
Images
-
Anti-RBP4 antibody (ab231587) at 2 µg/ml + Pig liver lysate.
Predicted band size: 23 kDa -
Anti-RBP4 antibody (ab231587) at 1 µg/ml + Pig serum.
Developed using the ECL technique.
Predicted band size: 23 kDa -
Anti-RBP4 antibody (ab231587) at 2 µg/ml + Cow liver lysate.
Developed using the ECL technique.
Predicted band size: 23 kDa -
Anti-RBP4 antibody (ab231587) at 2 µg/ml + Recombinant pig RBP4 protein.
Developed using the ECL technique.
Predicted band size: 23 kDa
Datasheets and documents
References
ab231587 has not yet been referenced specifically in any publications.