Anti-RBP4 antibody (ab231587)
Key features and details
- Rabbit polyclonal to RBP4
- Suitable for: WB
- Reacts with: Cow, Pig
- Isotype: IgG
Overview
-
Product name
Anti-RBP4 antibody
See all RBP4 primary antibodies -
Description
Rabbit polyclonal to RBP4 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Cow, Pig
Predicted to work with: Rabbit, Horse, Cat, Human, Chimpanzee
-
Immunogen
Recombinant fragment (His-tag) corresponding to Pig RBP4 aa 19-201. (Expressed in E.coli)
Sequence:ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDEN GHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKG NDDHWIIDTDYDTYAVQYSCRLQNLDGTCADSYSFVFARDPHGFSPEVQK IVRQRQEELCLARQYRIITHNGYCDGKSERNIL
Database link: P27485 -
Positive control
- WB: Recombinant pig RBP4 protein; Cow liver lysate; Pig serum and liver lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231587 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa. |
Target
-
Function
Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. -
Involvement in disease
Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 450617 Chimpanzee
- Entrez Gene: 281444 Cow
- Entrez Gene: 100049790 Horse
- Entrez Gene: 5950 Human
- Entrez Gene: 397124 Pig
- Entrez Gene: 100009161 Rabbit
- Omim: 180250 Human
- SwissProt: M5AXY1 Cat
see all -
Alternative names
- OTTHUMP00000020114 antibody
- OTTHUMP00000020115 antibody
- OTTHUMP00000020116 antibody
see all
Images
-
Western blot - Anti-RBP4 antibody (ab231587)Anti-RBP4 antibody (ab231587) at 2 µg/ml + Pig liver lysate.
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab231587)Anti-RBP4 antibody (ab231587) at 1 µg/ml + Pig serum.
Developed using the ECL technique.
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab231587)Anti-RBP4 antibody (ab231587) at 2 µg/ml + Cow liver lysate.
Developed using the ECL technique.
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab231587)Anti-RBP4 antibody (ab231587) at 2 µg/ml + Recombinant pig RBP4 protein.
Developed using the ECL technique.
Predicted band size: 23 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231587 has not yet been referenced specifically in any publications.
