Overview

  • Product name

  • Description

    Rabbit polyclonal to RBP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Goat, Cow, Human, Pig
    Predicted to work with: Rabbit, Horse, Cat, Chimpanzee
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Cow RBP4 aa 1-183. Expressed in E. coli. N-terminal tag.
    Sequence:

    ERDCRVSSFRVKENFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDEN GHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKG NDDHWIIDTDYETFAVQYSCRLLNLDGTCADSYSFVFARDPSGFSPEVQK IVRQRQEELCLARQYRLIPHNGYCDGKSERNIL


    Database link: P18902

  • Positive control

    • WB: Recombinant cow RBP4 protein; cow kidney and liver lysate; cow serum; goat plasma; HepG2 cell lysate; pig liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

Images

  • Anti-RBP4 antibody (ab231623) at 2 µg/ml + Pig liver lysate

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 2 µg/ml + Cow liver lysate

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 1 µg/ml + Goat plasma

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 1 µg/ml + Cow serum

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 2 µg/ml + Cow kidney lysate

    Predicted band size: 21 kDa

  • Anti-RBP4 antibody (ab231623) at 2 µg/ml + Recombinant cow RBP4 protein

    Predicted band size: 21 kDa

References

ab231623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up