Anti-RBP4 antibody (ab233138)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RBP4 antibody
See all RBP4 primary antibodies -
Description
Rabbit polyclonal to RBP4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Cow, Human
Predicted to work with: Rabbit, Horse, Cat, Pig, Chimpanzee
-
Immunogen
Recombinant full length protein (His-tag) corresponding to Human RBP4 aa 18-201. Mature chain. Expressed in E.coli.
Sequence:AERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDE TGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQK GNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQ KIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Database link: P02753 -
Positive control
- WB: Recombinant human RBP4 protein; Human serum; Human liver lysate; Mouse serum; Mouse liver lysate; Cow liver lysate. IHC-P: Human liver tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233138 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli. -
Involvement in disease
Defects in RBP4 are a cause of retinol-binding protein deficiency (RBP deficiency) [MIM:180250]. This condition causes night vision problems. It produces a typical 'fundus xerophthalmicus', featuring a progressed atrophy of the retinal pigment epithelium. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 450617 Chimpanzee
- Entrez Gene: 281444 Cow
- Entrez Gene: 100049790 Horse
- Entrez Gene: 5950 Human
- Entrez Gene: 19662 Mouse
- Entrez Gene: 397124 Pig
- Entrez Gene: 100009161 Rabbit
- Omim: 180250 Human
see all -
Alternative names
- OTTHUMP00000020114 antibody
- OTTHUMP00000020115 antibody
- OTTHUMP00000020116 antibody
see all
Images
-
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 2 µg/ml + Recombinant human RBP4 protein
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 1 µg/ml + Human serum
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 1 µg/ml + Human liver lysate
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 1 µg/ml + Mouse serum
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 1 µg/ml + Mouse liver lysate
Predicted band size: 23 kDa -
Western blot - Anti-RBP4 antibody (ab233138)Anti-RBP4 antibody (ab233138) at 1 µg/ml + Cow liver lysate
Predicted band size: 23 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RBP4 antibody (ab233138)Formalin-fixed, paraffin-embedded human liver tissue stained for RBP4 using ab233138 at 20 μg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab233138 has not yet been referenced specifically in any publications.
