Overview

  • Product name

    Anti-RBP5 antibody
  • Description

    Rabbit polyclonal to RBP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Cow RBP5 aa 1-135. Expressed in E.coli. N-terminal tag.
    Sequence:

    MGHHHHHHSGSMPPNLTGYYRFVSQKNLEDYLQALNVNMALRKIALLLKP DKEIDQRGNHMTVKTLSTFRNYVLEFEVGVEFEEDLRTVDGRKCQTIVTW EEEQLVCVQKGEVPNRGWRLWLEEEMLYQEVTARDAVCQCVFRKVK


    Database link: P82708

  • Positive control

    • WB: Recombinant cow RBP5; pig liver tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab231132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 16 kDa.

Target

  • Function

    Intracellular transport of retinol.
  • Tissue specificity

    Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular retinol-binding protein III antibody
    • CRBP III antibody
    • CRBP-III antibody
    • CRBP3 antibody
    • CRBPIII antibody
    • HRBPiso antibody
    • OTTHUMP00000238163 antibody
    • Putative cellular retinol binding protein CRBP III antibody
    • RBP5 antibody
    • RET5_HUMAN antibody
    • Retinol binding protein antibody
    • Retinol binding protein 5 antibody
    • Retinol binding protein 5, cellular antibody
    • Retinol-binding protein 5 antibody
    see all

Images

  • Anti-RBP5 antibody (ab231132) at 2 µg/ml + Pig liver tissue lysate

    Predicted band size: 16 kDa

  • Anti-RBP5 antibody (ab231132) at 2 µg/ml + Recombinant cow RBP5 protein

    Predicted band size: 16 kDa

References

ab231132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up