Overview

  • Product name

  • Description

    Rabbit polyclonal to RBPJK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human RBPJK aa 100-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    CAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGN S


    Database link: Q06330

  • Positive control

    • Human gastric carcinoma tissue; Human colon carcinoma lysate; Mouse embryo lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab217683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/100 - 1/1000. Predicted molecular weight: 56 kDa.

Target

  • Function

    Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence.
  • Sequence similarities

    Belongs to the Su(H) family.
    Contains 1 IPT/TIG domain.
  • Cellular localization

    Nucleus. Cytoplasm. Mainly nuclear, upon interaction with RITA/C12orf52, translocates to the cytoplasm, down-regulating the Notch signaling pathway.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI843960 antibody
    • AOS3 antibody
    • CBF 1 antibody
    • CBF-1 antibody
    • CBF1 antibody
    • csl antibody
    • IGKJRB antibody
    • IGKJRB1 antibody
    • J kappa recombination signal binding protein antibody
    • J kappa-recombination signal-binding protein antibody
    • KBF2 antibody
    • NY REN 30 antigen antibody
    • RBP J antibody
    • RBP J kappa antibody
    • RBP JK antibody
    • RBP-J antibody
    • RBP-J kappa antibody
    • RBP-JK antibody
    • Rbpj antibody
    • RBPJK antibody
    • RBPSUH antibody
    • recombination signal binding protein for immunoglobulin kappa J region antibody
    • Recombining binding protein suppressor of hairless antibody
    • Renal carcinoma antigen NY-REN-30 antibody
    • SUH antibody
    • SUH_HUMAN antibody
    see all

Images

  • All lanes : Anti-RBPJK antibody (ab217683) at 1/200 dilution

    Lane 1 : Mouse embryo lysate
    Lane 2 : Human colon carcinoma lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP

    Predicted band size: 56 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastric carcinoma tissue, labeling RBPJK with ab217683 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab217683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up