Overview

  • Product name

  • Description

    Rabbit polyclonal to RCL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human RCL aa 103-142 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    YELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQV


    Database link: O43598

  • Positive control

    • Human kidney tissue; Rat kidney and liver lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab212207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200. Predicted molecular weight: 19 kDa.

Target

  • Function

    Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases.
  • Tissue specificity

    Expressed at low levels in brain, colon, lung, peripheral blood leukocytes, placenta, small intestine, and thymus. Expressed at high levels in heart, kidney, liver, skeletal muscle and spleen. Overexpressed in a significant proportion of breast cancers.
  • Sequence similarities

    Belongs to the deoxyribonucleoside 5'-monophosphate N-glycosidase family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2' deoxynucleoside 5' phosphate N hydrolase 1 antibody
    • BC048355 antibody
    • c Myc responsive antibody
    • c Myc responsive protein Rcl antibody
    • c-Myc-responsive protein Rcl antibody
    • C6orf108 antibody
    • C76683 antibody
    • Chromosome 6 open reading frame 108 antibody
    • Deoxyribonucleoside 5' monophosphate N glycosidase antibody
    • Deoxyribonucleoside 5''-monophosphate N-glycosidase antibody
    • dJ330M21.3 antibody
    • DNPH1 antibody
    • MGC54855 antibody
    • Putative c Myc responsive antibody
    • Rcl antibody
    • RCL_HUMAN antibody
    • RP3 330M21.3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney labeling RCL with ab212207 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-RCL antibody (ab212207) at 1/200 dilution

    Lane 1 : Rat kidney lysates
    Lane 2 : Rat liver lysates

    Secondary
    All lanes : Goat anti-rabbit IgG (H+L), HRP at 1/3000 dilution

    Predicted band size: 19 kDa

References

ab212207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up