Overview

  • Product name

  • Description

    Rabbit polyclonal to RCN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse RCN2 aa 26-301. (Expressed in E.coli).
    Sequence:

    SKAEELHYPQGEHRADYDREALLGVQEDVDEYVKLGHEEQQRRLQSIIKK IDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGAVTWDEY NIQMYDRVIDFDENTALDDTEEGSFRQLHLKDKKRFEKANQDSGPGLSLE EFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRRDPTAN EDPEWILVEKDRFVNDYDKDNDGRLDPQELLSWVVPNNQGIAQEEALHLI DEMDLNSDKKLSEEEILENQDLFLTS


    Database link: Q8BP92

  • Positive control

    • IHC-P: Mouse testis and brain tissues. WB: Mouse lung lysate; Recombinant mouse RCN2 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231912 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse brain tissue stained for RCN2 using ab231912 at 20 µg/ml in immunohistochemical analysis. DAB-staining.

  • Anti-RCN2 antibody (ab231912) at 2 µg/ml + Mouse lung lysate.

    Predicted band size: 37 kDa

  • Anti-RCN2 antibody (ab231912) at 2 µg/ml + Recombinant mouse RCN2 protein.

    Predicted band size: 37 kDa

  • Paraffin-embedded mouse testis tissue stained for RCN2 using ab231912 at 20 µg/ml in immunohistochemical analysis. DAB-staining.

References

ab231912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up