Overview

  • Product name

    Anti-RDH10 antibody
  • Description

    Rabbit polyclonal to RDH10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human RDH10 aa 199-314.
    Sequence:

    LGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDT GMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTF MKSILPFEAVVCMYRF


    Database link: Q8IZV5

  • Positive control

    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling RDH10 with ab220635 at 4 μg/mL (green).

References

ab220635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up