Overview

  • Product name

  • Description

    Rabbit polyclonal to RDH12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RDH12 aa 182-316.
    Sequence:

    KIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPG VVRSELVRHSSLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKY FSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE


    Database link: Q96NR8

  • Positive control

    • IHC-P: Human skeletal muscle and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments.
  • Tissue specificity

    Widely expressed, mostly in eye, kidney, brain, skeletal msucle and stomach.
  • Involvement in disease

    Defects in RDH12 are the cause of Leber congenital amaurosis type 13 (LCA13) [MIM:612712]. LCA designates a clinically and genetically heterogeneous group of childhood retinal degenerations, generally inherited in an autosomal recessive manner. Affected infants have little or no retinal photoreceptor function as tested by electroretinography. LCA represents the most common genetic cause of congenital visual impairment in infants and children.
    Defects in RDH12 are the cause of retinitis pigmentosa type 53 (RP53) [MIM:612712]. RP53 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Information by UniProt
  • Database links

  • Alternative names

    • All trans and 9 cis retinol dehydrogenase antibody
    • All-trans and 9-cis retinol dehydrogenase antibody
    • LCA 3 antibody
    • LCA13 antibody
    • LCA3 antibody
    • RDH 12 antibody
    • RDH12 antibody
    • RDH12_HUMAN antibody
    • Retinol dehydrogenase 12 (all trans/9 cis/11 cis) antibody
    • Retinol dehydrogenase 12 all trans and 9 cis antibody
    • Retinol dehydrogenase 12 antibody
    • RP53 antibody
    • SDR7C2 antibody
    • Short chain dehydrogenase/reductase family 7C member 2 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for RDH12 using ab229764 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for RDH12 using ab229764 at 1/100 dilution in immunohistochemical analysis.

References

ab229764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up