Overview

  • Product name

    Anti-RDH8 antibody
  • Description

    Rabbit polyclonal to RDH8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 111-160 (FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASK F) of Human RDH8 (NP_056540).

  • Positive control

    • A549 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab133738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Function

    Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity.
  • Tissue specificity

    Detected in photoreceptor outer segments in the retina (at protein level).
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Photoreceptor outer segment all-trans retinol dehydrogenase antibody
    • PRRDH antibody
    • RDH8 antibody
    • RDH8_HUMAN antibody
    • Retinol dehydrogenase 8 (all-trans) antibody
    • Retinol dehydrogenase 8 antibody
    • SDR28C2 antibody
    • Short chain dehydrogenase/reductase family 28C, member 22 antibody
    see all

Images

  • Anti-RDH8 antibody (ab133738) at 1 µg/ml + A549 cell lysate at 10 µg

    Predicted band size: 34 kDa

References

This product has been referenced in:

  • Wong BH  et al. Mfsd2a Is a Transporter for the Essential ?-3 Fatty Acid Docosahexaenoic Acid (DHA) in Eye and Is Important for Photoreceptor Cell Development. J Biol Chem 291:10501-14 (2016). Read more (PubMed: 27008858) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up