Anti-REC8 antibody (ab235523)
Key features and details
- Rabbit polyclonal to REC8
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-REC8 antibody
See all REC8 primary antibodies -
Description
Rabbit polyclonal to REC8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human REC8 aa 1-270.
Sequence:MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVL VRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLH RAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMMSVDPRLPSPF DIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAE PIRMLEIEGERELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGI GEALGPEELRLTGWEPGALL
Database link: O95072 -
Positive control
- WB: Jurkat and HT-29 whole cell lysates. IHC-P: Human testis and colon cancer tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235523 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Predicted molecular weight: 63 kDa. | |
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II. -
Tissue specificity
Expressed in testis and thymus. -
Sequence similarities
Belongs to the rad21 family. -
Post-translational
modificationsPhosphorylated. -
Cellular localization
Nucleus. Chromosome. In meiotic chromosomes, localized along axial elements in prophase from the leptotene to diplotene stages. At later prophase stages, diakinesis and metaphase I, localized along interstitial axes of chromosomes including both centromere and arm regions. No longer detected in arm regions in anaphase I but persists on centromere regions until metaphase II. - Information by UniProt
-
Database links
- Entrez Gene: 9985 Human
- Omim: 608193 Human
- SwissProt: O95072 Human
- Unigene: 419259 Human
-
Alternative names
- Cohesin Rec8p antibody
- Human homolog of rad21 S. pombe antibody
- Meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REC8 antibody (ab235523)Paraffin-embedded human colon cancer tissue stained for REC8 using ab235523 at 1/100 dilution in immunohistochemical analysis.
-
Western blot - Anti-REC8 antibody (ab235523)All lanes : Anti-REC8 antibody (ab235523) at 1/1000 dilution
Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 2 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 63 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REC8 antibody (ab235523)Paraffin-embedded human testis tissue stained for REC8 using ab235523 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab235523 has not yet been referenced specifically in any publications.
