Anti-REC8 antibody (ab235523)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-REC8 antibody
See all REC8 primary antibodies -
Description
Rabbit polyclonal to REC8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human REC8 aa 1-270.
Sequence:MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVL VRVQPPQPGLPRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLH RAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMMSVDPRLPSPF DIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAE PIRMLEIEGERELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGI GEALGPEELRLTGWEPGALL
Database link: O95072 -
Positive control
- WB: Jurkat and HT-29 whole cell lysates. IHC-P: Human testis and colon cancer tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235523 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 63 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II. -
Tissue specificity
Expressed in testis and thymus. -
Sequence similarities
Belongs to the rad21 family. -
Post-translational
modificationsPhosphorylated. -
Cellular localization
Nucleus. Chromosome. In meiotic chromosomes, localized along axial elements in prophase from the leptotene to diplotene stages. At later prophase stages, diakinesis and metaphase I, localized along interstitial axes of chromosomes including both centromere and arm regions. No longer detected in arm regions in anaphase I but persists on centromere regions until metaphase II. - Information by UniProt
-
Database links
- Entrez Gene: 9985 Human
- Omim: 608193 Human
- SwissProt: O95072 Human
- Unigene: 419259 Human
-
Alternative names
- Cohesin Rec8p antibody
- Human homolog of rad21 S. pombe antibody
- Meiotic recombination and sister chromatid cohesion phosphoprotein of the rad21p family antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REC8 antibody (ab235523)
Paraffin-embedded human colon cancer tissue stained for REC8 using ab235523 at 1/100 dilution in immunohistochemical analysis.
-
All lanes : Anti-REC8 antibody (ab235523) at 1/1000 dilution
Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 2 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 63 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-REC8 antibody (ab235523)
Paraffin-embedded human testis tissue stained for REC8 using ab235523 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab235523 has not yet been referenced specifically in any publications.