Recombinant 3-phytase A protein (His tag) (ab235702)

Overview

  • Product name

    Recombinant 3-phytase A protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Aspergillus niger
    • Sequence

      ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRV TFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSL GADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKF IEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSEL ADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTST VDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANEL IARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALG LYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVR VLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
    • Molecular weight

      53 kDa including tags
    • Amino acids

      24 to 467
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature protein without the signal peptide (1-23aa)

Specifications

Our Abpromise guarantee covers the use of ab235702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • ab235702 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up