Recombinant A. thaliana BAS1 protein (His tag) (ab241226)

Description

  • Product name

    Recombinant A. thaliana BAS1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Arabidopsis thaliana
    • Sequence

      KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDF TFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLG DLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLG IGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSA I
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      66 to 266
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 66 to 266. The transit peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab241226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 2-Cys peroxiredoxin A
    • 2-Cys peroxiredoxin BAS1
    • 2-Cys Prx A
    • BAS1
    • BAS1A_ARATH
    • chloroplastic
    • Thiol-specific antioxidant protein A
    see all
  • Function

    May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.
  • Sequence similarities

    Belongs to the AhpC/TSA family.
    Contains 1 thioredoxin domain.
  • Post-translational
    modifications

    The Cys-119-SH group is the primary site of oxidation by H(2)O(2), and the oxidized Cys-119 (probably Cys-SOH) rapidly reacts with Cys-241-SH of the other subunit to form an intermolecular disulfide. This disulfide might subsequently be reduced by thioredoxin.
  • Cellular localization

    Plastid, chloroplast.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241226.

References

ab241226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up