Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      IDTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLAPFVQIQG KETSLVAFLKKLDWMVAVLADLDAVKRVAYENVADAALSGLDYAELRFSP YYMAMNHKLPIEGVVEAVVDGVKAGLKDYNVKINLIGIMSRSFGQAACTQ ELEGLLAHKQHLVAMDLAGDELGFPGELFNDHFKRVRDAGLAITAHAGEA AGSQSMWQAIQELGATRIGHGVNAIHDPKLMEYLAKHRIGIESCPTSNLH TSTVVSYAEHPFRTFMDAGVLISLNTDDPGVSAIDIKHEYRIAKSELKLT DAELARVQRNGVEMAFLSDSERKALYAAKI
    • Molecular weight

      37 kDa including tags
    • Amino acids

      2 to 331
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    >= 60 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.02% Potassium chloride, 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride

General Info

  • Alternative names

    • ada
    • ADA_HUMAN
    • ADA1
    • Adenosine aminohydrolase
    • Adenosine deaminase
    see all
  • Function

    Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion.
  • Tissue specificity

    Found in all tissues, occurs in large amounts in T-lymphocytes and, at the time of weaning, in gastrointestinal tissues.
  • Involvement in disease

    Defects in ADA are the cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-negative/NK-cell-negative due to adenosine deaminase deficiency (ADASCID) [MIM:102700]. SCID refers to a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients with SCID present in infancy with recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. ADA-SCID is an autosomal recessive form accounting for about 50% of non-X-linked SCIDs. ADA deficiency has been diagnosed in chronically ill teenagers and adults (late or adult onset). Population and newborn screening programs have also identified several healthy individuals with normal immunity who have partial ADA deficiency.
  • Sequence similarities

    Belongs to the adenosine and AMP deaminases family.
  • Cellular localization

    Cell membrane. Cell junction. Cytoplasmic vesicle lumen. Cytoplasm. Colocalized with DPP4 at the cell junction in lymphocyte-epithelial cell adhesion.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab135018 (6 µg) stained with Coomassie Blue.

References

ab135018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up