Recombinant algL protein (Tagged) (ab225669)

Description

  • Product name

    Recombinant algL protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Azotobacter vinelandii
    • Sequence

      AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARST LNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWA EDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRI ESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWA VEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGV DLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWL EPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKR D
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      24 to 374
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Azotobacter vinelandii protein with 10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus. This product is the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

Images

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225669 could indicate that this peptide derived from E.coli-expressed Azotobacter vinelandii algL.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225669 could indicate that this peptide derived from E.coli-expressed Azotobacter vinelandii algL.

References

ab225669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up