Recombinant Apoptin protein (Tagged) (ab225644)

Description

  • Product name

    Recombinant Apoptin protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Chicken anemia virus
    • Sequence

      MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCA NARAPTLRSATADNSESTGFKNVPDLRTDQPKPPSKKRSCDPSEYRVSEL KESLITTTPSRPRTAKRRIRL
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      1 to 121
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Chicken anemia virus (isolate Germany Cuxhaven-1) (CAV).

Specifications

Our Abpromise guarantee covers the use of ab225644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • VP3

References

ab225644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up