Description

  • Product name

    Recombinant Avian Influenza A Hemagglutinin protein
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.010 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPL ILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEE LKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFFRNVVWL IKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSV GTSTLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAP EYAYKIVKKGDSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIG ECPKYVKSNKLVLATGLRNSPLRER
    • Predicted molecular weight

      37 kDa
    • Amino acids

      17 to 341
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Influenza A virus (H5N8) (A/gyrfalcon/Washington/41088-6/2014). A0A0C4X0C0-1

Specifications

Our Abpromise guarantee covers the use of ab217663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    Preservative: 0.01% Sodium azide
    Constituents: 79% PBS, 20% Glycerol

General Info

  • Alternative names

    • HA1
    • HA2
    • Hemagglutinin
    • Hemagglutinin ha1 chain
    • Hemagglutinin ha2 chain
    • Hemagglutinin precursor
    see all
  • Relevance

    Influenza A virus is a major public health threat, killing more than 30,000 people per year in the USA. Novel influenza virus strains caused by genetic drift and viral recombination emerge periodically to which humans have little or no immunity, resulting in devastating pandemics. Influenza A can exist in a variety of animals; however it is in birds that all subtypes can be found. These subtypes are classified based on the combination of the virus coat glycoproteins hemagglutinin (HA) and neuraminidase (NA) subtypes. HA interacts with cell surface proteins containing oligosaccharides with terminal sialyl residues. Virus isolated from a human infected with the H5N1 strain in 1997 could bind to oligosaccharides from human as well as avian sources, indicating its species-jumping ability.
  • Cellular localization

    Cell Membrane

Images

  • 10% SDS-PAGE analysis of ab217663.

References

ab217663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up