Recombinant B. pertussis Pertactin autotransporter protein (Tagged) (ab224861)

Overview

  • Product name

    Recombinant B. pertussis Pertactin autotransporter protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Bordetella pertussis
    • Sequence

      ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADH AVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFY LDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWF LEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGG RQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRG HSLYASYEYSKGPKLAMPWTFHAGYRYSW
    • Molecular weight

      46 kDa including tags
    • Amino acids

      632 to 910
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus (Strain Tohama I / ATCC BAA-589 / NCTC 13251) .

Specifications

Our Abpromise guarantee covers the use of ab224861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • P.93
    • prn

Images

  • SDS-PAGE - Recombinant B. pertussis Pertactin autotransporter protein (His tag) (ab224861) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224861 with 5% enrichment gel and 15% separation gel.

References

ab224861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up