Recombinant B. subtilis Penicillin-binding protein 4* (His tag) (ab226290)

Description

  • Product name

    Recombinant B. subtilis Penicillin-binding protein 4* (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Bacillus subtilis
    • Sequence

      MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRP LKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTI RHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEG WMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPE RIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLF RFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIV SHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQ PYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIA GQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRT K
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 451
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain 168. 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • PBP 4*
    • PBP 4A
    • pbpE
    • Penicillin-binding protein E
  • Relevance

    Function: Probably involved in peptidoglycan modification during cortex synthesis.
  • Cellular localization

    Cell Membrane

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226290 with 5% enrichment gel and 15% separation gel.

References

ab226290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up