Recombinant B. subtilis Uncharacterized protein YuaB (Active) (ab235612)

Description

  • Product name

    Recombinant B. subtilis Uncharacterized protein YuaB (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab235612 at 5 μg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.

  • Purity

    > 90 % SDS-PAGE.
    Purified from an in vitro E.coli expression system.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Bacillus subtilis
    • Sequence

      MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASL FATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNG NALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAEN KSLSIGNKFYAEASIDVAKRSTPPTQPCGCN
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 181
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged. In vitro E.coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • ab235612 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Measured by its binding ability in a functional ELISA. Immobilized ab235612 at 5 μg/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.

References

ab235612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up