Overview

  • Product name

    Recombinant Beta Lactamase protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGL IVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGG MDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFG PLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEH YAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR
    • Molecular weight

      42 kDa including tags
    • Amino acids

      29 to 270
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Species: Klebsiella pneumoniae. Full-length mature chain lacking the signal peptide. N-terminal 6xHis-SUMO-tagged

Specifications

Our Abpromise guarantee covers the use of ab238278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AmpA
    • AmpC
    • Cephalosporinase
  • Relevance

    The beta lactam antibiotics (penicillins and cephalosporins) are the most frequently used antimicrobial agents. All of the beta lactams are structurally related through the presence of a core beta lactam ring. Bacterial resistance to beta lactams continues to increase, primarily due to the production of beta lactamases. Beta lactamases catalyze the hydrolysis of the beta lactam bond, which destroys antibacterial activity. Bacteria that produce TEM type or SHV type beta lactamases have point mutations in structural genes that have extended the substrate specificity of these beta lactamases. As a result, many of the beta lactamase producing Gram negative pathogens have become multidrug resistant.

Images

  • ab238278 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238278 could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae Beta Lactamase.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238278 could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae Beta Lactamase.

References

ab238278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up