Description

  • Product name

    Recombinant beta subunit Cholera Toxin protein
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Bacteria
    • Sequence

      TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQV EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS MAN
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      22 to 124
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature chain of Vibrio cholerae serotype O1 beta subunit Cholera Toxin without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab219659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 5% Trehalose, PBS

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Cholera enterotoxin B chain
    • Cholera enterotoxin beta chain
    • Cholera enterotoxin gamma chain
    • Cholera enterotoxin subunit B
    • Cholera toxin B protein
    • Choleragenoid
    • CTX B
    • CTXB
    • TOX B
    • TOXB
    • VC1456
    see all
  • Cellular localization

    Secreted

Images

  • SDS-PAGE using ab219659. The protein migrates at 18-22 kDa.

References

ab219659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up