Description

  • Product name

    Recombinant BK polyomavirus, strain AS, Major Capsid VP1 protein
    See all BK polyomavirus, strain AS, Major Capsid VP1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by ultracentifugation.
  • Expression system

    Saccharomyces cerevisiae
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      BK virus
    • Sequence

      MAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVEC FLNPEMGDPDDNLRGYSQHLSAENAFESDSPDRKMLPCYSTARIPLPNLN EDLTCGNLLMWEAVTVKTEVIGITSMLNLHAGSQKVHENGGGKPVQGSNF HFFAVGGDPLEMQGVLMNYRTKYPQGTITPKNPTAQSQVMNTDHKAYLDK NNAYPVECWIPDPSRNENTRYFGTYTGGENVPPVLHVTNTATTVLLDEQG VGPLCKADSLYVSAADICGLFTNSSGTQQWRGLARYFKIRLRKRSVKNPY PISFLLSDLINRRTQKVDGQPMYGMESQVEEVRVFDGTEQLPGDPDMIRY IDRQGQLQTKMV

Specifications

Our Abpromise guarantee covers the use of ab74567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C long term. Reconstitute for long term storage.

    Constituent: PBS

  • Reconstitution
    Reconstitute with deionized H20. With the addition of glycerol store at -20°C. After reconstitution can only be stored at 4°C for 2-3 days.

General Info

  • Alternative names

    • Capsid protein VP1
  • Relevance

    BK polyomavirus was first isolated in 1971 in the urine of a renal transplant patient, initials B.K. BK polyomavirus, Major Capsid VP1 forms the icosaedric capsid of the virus protecting the viral genome. This capsid is composed of 360 VP1, assembled in 72 pentamers. Each pentamer are linked via the C-terminal end of VP1.
  • Cellular localization

    Virion. Nucleus

Images

  • SDS-PAGE showing ab74567 at approximately 44kDa (3.2µg/lane). 
    Lane 1 shows the molecular weight ladder. From the bottom: 14.4, 18.4, 25.0, 35.0, 45.0, 66.2, 116.0 kDa.

References

ab74567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Vielen Dank für Ihre Anfrage.

Meiner Meinung nach sollte das Signal mit diesem sekundären Antikörper stark genug sein wenn Sie polyklonale anti BK polyomavirus -Antikörper in Ihren Proben haben.

Allerdings möchte ich Sie darauf hinweisen, dass das natürlich stark von der Menge der Antikörper abhängt und u.U. das zu testende Serum unverdünnt eingesetzt werden muss.

Generell haben Sie natürlich Recht, dass ein Biotin konjugierter sekundärer mit Streptavidin-HRP zu einer Amplifizerung des Signals führt und es somit stärker wird. (Achtung auch der Hintergrund kann sich erhöhen)

Außerdem wird mit ab102415 beides IgM und IgG gleichzeitig nachgewiesen. Ist das für Ihr Experiment richtig?

Ich hoffe, diese Information ist hilfreich und wünsche Ihnen viel Erfolg beim Ihren Versuchen.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up