Description

  • Product name

    Recombinant BK polyomavirus, strain AS, Major Capsid VP1 protein (Tagged)
    See all BK polyomavirus, strain AS, Major Capsid VP1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVEC FLNPEMGDPDENLRGFSLKLSAENDFSSDSPERKMLPCYSTARIPLPNLN EDLTCGNLLMWEAVTVQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNF HFFAVGGEPLEMQGVLMNYRSKYPDGTITPKNPTAQSQVMNTDHKAYLDK NNAYPVECWVPDPSRNENARYFGTFTGGENVPPVLHVTNTATTVLLDEQG VGPLCKADSLYVSAADICGLFTNSSGTQQWRGLARYFKIRLRKRSVKNPY PISFLLSDLINRRTQRVDGQPMYGMESQVEEVRVFDGTERLPGDPDMIRY IDKQGQLQTKML
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 362
    • Tags

      His tag N-Terminus
    • Additional sequence information

      BK polyomavirus (BKPyV). N-terminal 10xHis-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab237745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Capsid protein VP1
  • Relevance

    BK polyomavirus was first isolated in 1971 in the urine of a renal transplant patient, initials B.K. BK polyomavirus, Major Capsid VP1 forms the icosaedric capsid of the virus protecting the viral genome. This capsid is composed of 360 VP1, assembled in 72 pentamers. Each pentamer are linked via the C-terminal end of VP1.
  • Cellular localization

    Virion. Nucleus

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237745.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237745 could indicate that this peptide derived from E.coli-expressed BK polyomavirus (BKPyV) (Human polyomavirus 1) Major Capsid VP1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237745 could indicate that this peptide derived from E.coli-expressed BK polyomavirus (BKPyV) (Human polyomavirus 1) Major Capsid VP1.

References

ab237745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up