Overview

  • Product name

    Recombinant C4 Protease protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Tobacco Vein Mottling Virus
  • Amino Acid Sequence
    • Accession
    • Species

      Tobacco vein mottling virus
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKALLKGVRDFNPISACVWLL ENSSDGHSERLFGIGFGPYIIANQHLFRRNNGELTIKTMHGEFKVKNSTQ LQMKPVEGRDIIVIKMAKDFPPFPQKLKFRQPTIKDRVCMVSTNFQQKSV SSLVSESSHIVHKEDTSFWQHWITTKDGQCGSPLVSIIDGNILGIHSLTH TTNGSNYFVEFPEKFVATYLDAADGWCKNWKFNADKISWGSFTLVEDAPE DDFMAKKTVAAIMD
    • Molecular weight

      30 kDa including tags
    • Amino acids

      2002 to 2236
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    C4 Protease could be easily removed from the cleavage reaction by affinity chromatography using the polyhistidine tag at N-terminal. Complete digestion 50ug of MBP-IL6 fusion protein using 1 ug TVMV C4 Protease (in 1:50 ratio) for 12 hours at 4C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 79% PBS, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Relevance

    This peptidase is present in the nuclear inclusion protein of potyviruses. TVMV C4 protease derived from Tobacco Vein Mottling Virus, recognizes a linear epitope of the general form T_V_R_F_Q / S with cleavage occurring between Q and S. The protease is used to cleave affinity tag from fusion protein. The optimal temperature for cleavage is 30 °C.

References

ab134862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up