Bioactive grade

Recombinant cat beta 2 Microglobulin + FCGRT heterodimer protein (Active) (Biotin) (ab246073)

Description

  • Product name

    Recombinant cat beta 2 Microglobulin + FCGRT heterodimer protein (Active) (Biotin)
  • Biological activity

    Immobilized Ipilumimab at 5 μg/mL (100 μL/well) can bind ab246073 with a linear range of 0.02-0.156 μg/mL (QC tested).

  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Cat
    • Sequence

      AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNNMRAQAEPCGA WVWENQVSWYWEKETTDLRNKQELFLEALKVLGEGGPYTLQGLLGCELGP DNASVPVAKFALNGEDFMDFDPKLGTWSGEWPETETISKRWMQEAGAVSK ERTFLLNSCPQRLLGHLERGRGNLEWKEPPSMRLKARPGSPGFSVLTCSA FSFYPPELQLRFLRNGLAAGSGEGDFGPNGDGSFHAWSSLTVKSGDEHHY RCLVQHAGLPQPLTVELESPAKSS
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      24 to 297
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. AviTag sequence: GLNDIFEAQKIEWHE
    • Amino Acid Sequence 2

    • Species

      Cat
    • Sequence

      VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQ TDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      21 to 118
    • Additional sequence information

      Full length protein without the signal pepide.
  • Conjugation

    Biotin
  • Description

    Recombinant cat beta 2 Microglobulin + FCGRT/FCRN protein (Active) (Biotin)

Specifications

Our Abpromise guarantee covers the use of ab246073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Cellular localization

    beta 2 Microglobulin: Secreted. Detected in serum and urine. FCGRT: Cell membrane.

Images

  • SDS-PAGE analysis of ab246073 under reducing conditions.

    The protein has a calculated MW of 34.0 kDa (FCGRT) and 11.5 kDa (beta 2 Microglobulin) . The protein migrates as 36-40 kDa (FCGRT) and 18-20 kDa (beta 2 Microglobulin) respectively on a SDS-PAGE gel under reducing conditions due to glycosylation.

     

  • Immobilized Ipilumimab at 5 μg/mL (100 μL/well) can bind ab246073 with a linear range of 0.02-0.156 μg/mL (QC tested).

References

ab246073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up