Description

  • Product name

    Recombinant Cat CXCL9 protein
    See all CXCL9 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cat
    • Sequence

      TLIMRNRRCFCINTSQGTIHLKSLKDLKQFAPSPSCEKTEIIVTMKNGDQ TCLNPDSADVQELIKEWEKQVSQKKKQKKGKKNQKSRKIFKVKKSQHPHQ KKTT
    • Predicted molecular weight

      12 kDa
    • Amino acids

      23 to 126
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209154 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. ab209154 can be used in cell culture, as an CXCL9 ELISA Standard, and as a Western Blot Control.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Once reconstituted store at – 20 °C in working aliquots and avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • C-X-C motif chemokine 9
    • chemokine (C-X-C motif) ligand 9
    • CMK
    • crg-10
    • CXCL9
    • CXCL9_HUMAN
    • gamma interferon induced monokine
    • Gamma-interferon-induced monokine
    • HuMIG
    • MIG
    • monokine induced by gamma interferon
    • monokine induced by interferon gamma
    • Monokine induced by interferon-gamma
    • SCYB9
    • Small inducible cytokine B9
    • small inducible cytokine subfamily B member 9
    • Small-inducible cytokine B9
    see all
  • Function

    Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up