Bioactive grade

Recombinant cat IL-2 (mutated C146 S) protein (Active) (ab223097)

Description

  • Product name

    Recombinant cat IL-2 (mutated C146 S) protein (Active)
    See all IL-2 proteins and peptides
  • Biological activity

    Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 0.3 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    ab223097 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cat
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSAPASSSTKETQQQLEQLLLDLRLLLNG VNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKN FHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFSQ SIFSTLT
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      21 to 154
    • Modifications

      mutated C146
    • Tags

      His tag N-Terminus
    • Additional sequence information

      C146S mutation. This product is the mature full length protein from aa 21 to 154. The signal peptide is not included (NP_001036802).

Specifications

Our Abpromise guarantee covers the use of ab223097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 30% Glycerol, 0.87% Sodium chloride, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • interleukin2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223097.

References

ab223097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up