Recombinant cat IL-2 (mutated C146S) protein (Active) (ab223097)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE, MS
Description
-
Product name
Recombinant cat IL-2 (mutated C146S) protein (Active)
See all IL-2 proteins and peptides -
Biological activity
Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 0.3 ng/ml.
-
Purity
> 95 % SDS-PAGE.
ab223097 was purified using conventional chromatography techniques. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Cat -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSAPASSSTKETQQQLEQLLLDLRLLLNG VNNPENPKLSRMLTFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKN FHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITFSQ SIFSTLT -
Predicted molecular weight
18 kDa including tags -
Amino acids
21 to 154 -
Modifications
mutated C146 -
Tags
His tag N-Terminus -
Additional sequence information
C146S mutation. This product is the mature full length protein from aa 21 to 154. The signal peptide is not included (NP_001036802).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab223097 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 30% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.32% Tris HClThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Aldesleukin
- IL 2
- IL-2
see all -
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. -
Involvement in disease
Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. -
Sequence similarities
Belongs to the IL-2 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab223097 has not yet been referenced specifically in any publications.