Description

  • Product name

    Recombinant Cat Serum Amyloid A protein (His tag)
    See all Serum Amyloid A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cat
    • Sequence

      EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGG AWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      19 to 111
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-B2M tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Amyloid fibrils
    • SAA 2
    • Serum amyloid A1 isoform 2
    • TP53I4
    • Amyloid fibril protein AA
    • Amyloid protein A
    • Fibrils
    • MGC111216
    • OC
    • OTTMUSP0000004557
    • PIG 4
    • PIG4
    • SAA
    • SAA 1
    • SAA_HUMAN
    • SAA1
    • SAA2
    • serum amyloid A
    • Serum amyloid A 1
    • Serum amyloid A protein precursor
    • Serum amyloid A1 isoform 1
    • Serum amyloid protein A(4-101)
    • Tumor protein p53 inducible protein 4
    see all
  • Relevance

    Function: Major acute phase reactant. Apolipoprotein of the HDL complex. Tissue specificity: Expressed by the liver; secreted in plasma. Disease: Note=Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Note=Elevated serum SAA protein levels may be associated with lung cancer. Similarity: Belongs to the SAA family. PTM: This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.

Images

  • Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) analysis of ab224867 with 5% enrichment gel and 15% separation gel.

References

ab224867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up