Recombinant Chicken Interferon beta protein (His tag) (ab239440)

Description

  • Product name

    Recombinant Chicken Interferon beta protein (His tag)
    See all Interferon beta proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Chicken
    • Sequence

      CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKK QAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFV NQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCF RHVDTLIQWMKSRAPLTASSKRLNTQ
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      28 to 203
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length mature chain lacking the signal peptide. N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • beta-interferon
    • Fibroblast interferon
    • IFB
    • IFF
    • IFN beta
    • IFN-beta
    • IFNB
    • IFNB 1
    • IFNB_HUMAN
    • IFNB1
    • Interferon beta
    • Interferon beta 1 fibroblast
    • Interferon beta precursor
    • MGC96956
    see all
  • Function

    Has antiviral, antibacterial and anticancer activities.
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab239440 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up