Description

  • Product name

    Recombinant Chicken RANTES protein
    See all RANTES proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab203717 was purified by ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Chicken
    • Sequence

      SPFGADTTVCCFNYSVRKLPQNHVKDYFYTSSKCPQAAVVFITRKGRQVC ANPDARWVKEYINFLELQ
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 91
    • Additional sequence information

      Unreviewed UniProt Q8QG57. This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab203717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Other

    Western blot

    ELISA

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile PBS containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • Beta chemokine RANTES
    • Beta chemokine RANTES precursor
    • C C motif chemokine 5
    • CCL 5
    • CCL5
    • CCL5_HUMAN
    • Chemokine (C C motif) ligand 5
    • Chemokine CC Motif Ligand 5
    • D17S136E
    • EoCP
    • Eosinophil chemotactic cytokine
    • MGC17164
    • RANTES(4-68)
    • Regulated upon activation normally T expressed and presumably secreted
    • SCYA 5
    • SCYA5
    • SIS delta
    • SIS-delta
    • SISd
    • Small inducible cytokine A5
    • Small inducible cytokine A5 (RANTES)
    • Small inducible cytokine subfamily A (Cys Cys) member 5
    • Small-inducible cytokine A5
    • T cell specific protein p288
    • T cell specific protein RANTES
    • T cell specific RANTES protein
    • T cell-specific protein P228
    • T-cell-specific protein RANTES
    • TCP 228
    • TCP228
    see all
  • Function

    Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
  • Tissue specificity

    T-cell and macrophage specific.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
    The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab203717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up