Description

  • Product name

    Recombinant Chinese hamster Cathepsin D protein (Tagged)
    See all Cathepsin D proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Chinese hamster
    • Sequence

      GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLD IACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQ PGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNL MQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKA YWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAV PLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLS GFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      65 to 408
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CatD
    • CATD_HUMAN
    • Cathepsin D
    • Cathepsin D heavy chain
    • CD
    • Ceroid lipofuscinosis neuronal 10
    • CLN10
    • CPSD
    • ctsd
    • Epididymis secretory sperm binding protein Li 130P
    • HEL S 130P
    • Lysosomal aspartyl peptidase
    • Lysosomal aspartyl protease
    • MGC2311
    see all
  • Function

    Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
  • Tissue specificity

    Expressed in the aorta extrcellular space (at protein level).
  • Involvement in disease

    Ceroid lipofuscinosis, neuronal, 10
  • Sequence similarities

    Belongs to the peptidase A1 family.
    Contains 1 peptidase A1 domain.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Lysosome. Melanosome. Secreted, extracellular space. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. In aortic samples, detected as an extracellular protein loosely bound to the matrix (PubMed:20551380).
  • Information by UniProt

Images

  • (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235074.

References

ab235074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up