Recombinant Chlamydia trachomatis Chlamydia trachomatis MOMP protein (Tagged) (ab226442)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Chlamydia trachomatis
    • Sequence

      LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDR VLQTDVNKEFQMGAKPTTATGNAAAPSTCTARENPAYGRHMQDAEMFTNA AYMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENHATVSDSK LVPNMSLDQSVVELYTDTTFAWSAGARAALWECGCATLGASFQYAQSKPK VEELNVLCNAAEFTINKPKGYVGQEFPLDLKAGTDGVTGTKDASIDYHEW QASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSATTVFDVTTLNP TIAGAGDVKASAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKY AVTVETRLIDERAAHVNAQFRF
    • Molecular weight

      56 kDa including tags
    • Amino acids

      23 to 394
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Serovar L2 (strain 434/Bu / ATCC VR-902B). This product is the mature full length protein from aa 23 to 394 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Major Outer Membrane Protein
    • MOMP
    • omp1
    • omp1F
    • Omp1L1
    • ompA
    • ompIL2
    see all
  • Relevance

    Chlamydia is caused by the bacterium Chlamydia trachomatis. The intracytoplasmic inclusions caused by the bacterium are draped around the infected cell's nucleus. Chlamydia trachomatis is an intracellular organism that has a genome size of approximately 500-1000 kilobases and contains both RNA and DNA. The organism is also extremely temperature sensitive and must be refrigerated at 4°C as soon as a sample is obtained. Colonization of Chlamydia begins with attachment to sialic acid receptors on the eye, throat or genitalia. It persists at body sites that are inaccessible to phagocytes, T cells, and B cells. It also exists as 15 different serotypes. These serotypes cause four major diseases in humans: endemic trachoma (caused by serotypes A and C), sexually transmitted disease and inclusion conjunctivitis (caused by serotypes D and K), and lymphogranuloma venereum (caused by serotypes L1, L2, and L3). Studies reveal that Chlamydia, because of its cell wall, is able to inhibit phagolysosome fusion in phagocytes. The cell wall is proposed to be Gram negative in that it contains an outer lipopolysaccharide membrane, but it lacks peptidoglycan in its cell wall. This lack of peptidoglycan is shown by the inability to detect muramic acid and antibodies directed against it. It may, however, contain a carboxylated sugar other than muramic acid. The proposed structure consists of a major outer membrane protein cross linked with disulfide bonds. It also contains cysteine rich proteins (CRP) that may be the functional equivalent to peptidoglycan. This unique structure allows for intracellular division and extracellular survival (Hatch 1996). Chlamydia usually infects the cervix and fallopian tubes of women and the urethra of men. Chlamydial infections are believed to be one of the most common of all STDs. It is generally thought that in a population of 15 million, there are up to 300,000 cases of chlamydia each year. Thus, there are many undiagnosed cases of chlamydia in the community. It has been estimated that the true prevalence of chlamydia in the sexually active population may be in the order of 5% to 10%. Chlamydia is one of the leading causes of blindness in underdeveloped countries.
  • Cellular localization

    Outer membrane; multi pass membrane protein.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226442 with 5% enrichment gel and 15% separation gel.

References

ab226442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up