Recombinant Chlamydia trachomatis OmcB protein (His tag) (ab224862)

Overview

  • Product name

    Recombinant Chlamydia trachomatis OmcB protein (His tag)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Chlamydia trachomatis
    • Sequence

      LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFG RMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQL PCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFT AATVCA
    • Molecular weight

      33 kDa including tags
    • Amino acids

      41 to 196
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Large cysteine-rich periplasmic protein OmcB

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE  (reduced) analysis of ab224862 with 5% enrichment gel and 15% separation gel.

References

ab224862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up