Description

  • Product name

    Recombinant Clostridium botulinum HA1 protein (Tagged)
    See all HA1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Clostridium botulinum
    • Sequence

      SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLI YDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYIS RNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRN CKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKC QENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDT NRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      2 to 286
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • HLA HA1
    • hmha1
    • HMHA1_HUMAN
    • KIAA0223
    • mHag HA-1
    • Minor histocompatibility antigen HA 1
    • Minor histocompatibility antigen HA-1
    • Minor histocompatibility protein HA 1
    see all
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236932.

References

ab236932 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up