Recombinant clpP2 protein (Tagged) (ab238223)

Description

  • Product name

    Recombinant clpP2 protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEAL DFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIF LAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNII SKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 198
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680). N-terminal 10xHis-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab238223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ATP dependent Clp protease proteolytic subunit 2
    • Endopeptidase Clp 2

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab238223.

References

ab238223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up