Description

  • Product name

    Recombinant Cow CCR5 protein
    See all CCR5 proteins and peptides
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      PFGADTPTACCFSYVARQLSRKIVADYFETSSQCSKPGVIFQTKKGRQVC ANPTEDWVQEYITDLELNA
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 93
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab204192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • AM4 7
    • C C chemokine receptor type 5
    • C C CKR 5
    • C-C chemokine receptor type 5
    • C-C CKR-5
    • C-C motif chemokine receptor 5 A159A
    • CC Chemokine Receptor 5
    • CC Chemokine Receptor Type 5
    • CC CKR 5
    • CC-CKR-5
    • CCCKR 5
    • CCCKR5
    • CCR 5
    • CCR-5
    • CCR5
    • CCR5 chemokine (C C motif) receptor 5
    • CCR5_HUMAN
    • CD 195
    • CD195
    • CD195 Antigen
    • Chemokine C C motif receptor 5
    • Chemokine receptor CCR5
    • CHEMR13
    • CKR 5
    • CKR5
    • CMKBR 5
    • CMKBR5
    • FLJ78003
    • HIV 1 Fusion Coreceptor
    • HIV-1 fusion coreceptor
    • HIV1 fusion coreceptor
    • IDDM22
    • MIP-1 alpha receptor
    see all
  • Function

    Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.
  • Tissue specificity

    Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1A and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.
  • Involvement in disease

    Genetic variation in CCR5 is associated with suseptibility to diabetes mellitus insulin-dependent type 22 (IDDM22) [MIM:612522]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4.
    O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen.
    Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry.
    Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab204192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up