Description

  • Product name

    Recombinant Cow GLTP protein (His tag)
    See all GLTP proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      ALLAEHLLRPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG NITKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKRGL RFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAA LYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRM NAELNYKV
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      2 to 209
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • GLTP
    • GLTP_HUMAN
    • Glycolipid transfer protein
  • Function

    Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides.
  • Tissue specificity

    Detected in fibroblasts (at protein level). Detected in fibroblasts and in various cancer cell lines.
  • Sequence similarities

    Belongs to the GLTP family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239567.

References

ab239567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up