Description

  • Product name

    Recombinant Cow GNAT2 protein (His tag)
    See all GNAT2 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVK QMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCV DNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDS ASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDV GGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFN SICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGN YIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDC GLF
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      2 to 254
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ACHM4
    • Cone type transducin alpha subunit
    • GNAT 2
    • GNAT C
    • Gnat2
    • GNAT2_HUMAN
    • GNATC
    • Guanine nucleotide binding protein (G protein) alpha transducing activity polypeptide 2
    • Guanine nucleotide binding protein G t subunit alpha 2
    • Guanine nucleotide-binding protein G(t) subunit alpha-2
    • Transducin alpha 2
    • Transducin alpha-2 chain
    • Transducin alpha2
    • Transducin cone specific alpha polypeptide
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.
  • Tissue specificity

    Retinal rod outer segment.
  • Involvement in disease

    Defects in GNAT2 are the cause of achromatopsia type 4 (ACHM4) [MIM:139340]. Achromatopsia is an autosomal recessively inherited visual disorder that is present from birth and that features the absence of color discrimination.
  • Sequence similarities

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Information by UniProt

Images

  • ab235705 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up