Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Cow
    • Sequence

      CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQE AQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACL GLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMR SLSSSTSLQERLRMMDGDLKSP
    • Molecular weight

      36 kDa including tags
    • Amino acids

      24 to 195
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 195 with 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab224844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • IFNW1
    • IFNW1_HUMAN
    • Interferon alpha II 1
    • Interferon alpha-II-1
    • Interferon omega 1
    • Interferon omega-1
    see all
  • Sequence similarities

    Belongs to the alpha/beta interferon family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab224844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up